General Information

  • ID:  hor002127
  • Uniprot ID:  P18254
  • Protein name:  Insulin-like growth factor I
  • Gene name:  IGF1
  • Organism:  Gallus gallus (Chicken)
  • Family:  Insulin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Gallus (genus), Phasianinae (subfamily), Phasianidae (family), Galliformes (order), Galloanserae (superorder), Neognathae (infraclass), Aves (class), Coelurosauria, Theropoda, Saurischia, Dinosauria, Archosauria, Archelosauria, Sauria, Sauropsida, Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005159 insulin-like growth factor receptor binding; GO:0005179 hormone activity; GO:0008083 growth factor activity
  • GO BP:  GO:0001932 regulation of protein phosphorylation; GO:0007405 neuroblast proliferation; GO:0008283 cell population proliferation; GO:0008284 positive regulation of cell population proliferation; GO:0009408 response to heat; GO:0010467 gene expression; GO:0010648 negative regulation of cell communication; GO:0021650 vestibulocochlear nerve formation; GO:0023057 negative regulation of signaling; GO:0043066 negative regulation of apoptotic process; GO:0043524 negative regulation of neuron apoptotic process; GO:0045732 positive regulation of protein catabolic process; GO:0046676 negative regulation of insulin secretion; GO:0048009 insulin-like growth factor receptor signaling pathway; GO:0048856 anatomical structure development; GO:0050896 response to stimulus; GO:0051897 positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction; GO:0061560 cranial ganglion formation; GO:0090103 cochlea morphogenesis; GO:0090201 negative regulation of release of cytochrome c from mitochondria; GO:0090277 positive regulation of peptide hormone secretion; GO:1990418 response to insulin-like growth factor stimulus
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  GPETLCGAELVDALQFVCGDRGFYFSKPTGYGSSSRRLHHKGIVDECCFQSCDLRRLEMYCAPIKPPKSA
  • Length:  70(49-118)
  • Propeptide:  MEKINSLSTQLVKCCFCDFLKVKMHTVSYIHFFYLGLCLLTLTSSAAAGPETLCGAELVDALQFVCGDRGFYFSKPTGYGSSSRRLHHKGIVDECCFQSCDLRRLEMYCAPIKPPKSARSVRAQRHTDMPKAQKEVHLKNTSRGNTGNRNYRM
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity. Binds to integrins.
  • Mechanism:  Binds to the alpha subunit of IGF1R, leading to the activation of the intrinsic tyrosine kinase activity which autophosphorylates tyrosine residues in the beta subunit thus initiatiating a cascade of down-stream signaling events leading to activation of the PI3K-AKT/PKB and the Ras-MAPK pathways.
  • Cross BBB:  NA
  • Target:  INSR
  • Target Unid:   A0A1D5P6T3
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  6-48; 18-61; 47-52
  • Structure ID:  AF-P18254-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002127_AF2.pdbhor002127_ESM.pdb

Physical Information

Mass: 897481 Formula: C338H525N95O100S7
Absent amino acids: NW Common amino acids: GCLS
pI: 7.78 Basic residues: 11
Polar residues: 24 Hydrophobic residues: 19
Hydrophobicity: -29.57 Boman Index: -11803
Half-Life / Aliphatic Index: 30 hour Aliphatic Index: 62.71
Instability Index: 6173.86 Extinction Coefficient cystines: 4845
Absorbance 280nm: 70.22

Literature

  • PubMed ID:  2272467
  • Title:  Chicken Insulin-Like Growth factor-I: Amino Acid Sequence, Radioimmunoassay, and Plasma Levels Between Strains and During Growth